Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM50031588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441637
Kd 2500±n/a nM
Citation Dudutiene, VMatuliene, JSmirnov, ATimm, DDZubriene, ABaranauskiene, LMorkunaite, VSmirnoviene, JMichailoviene, VJuozapaitiene, VMickeviciute, AKazokaite, JBak?yte, SKasiliauskaite, AJachno, JRevuckiene, JKi?onaite, MPilipuityte, VIvanauskaite, EMilinaviciute, GSmirnovas, VPetrikaite, VKairys, VPetrauskas, VNorvai?as, PLinge, DGibie?a, PCapkauskaite, EZak?auskas, AKazlauskas, EManakova, EGra?ulis, SLadbury, JEMatulis, D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031588
NameBDBM50031588
Synonyms:CHEMBL3359181
TypeSmall organic molecule
Emp. Form.C16H23F3N2O5S2
Mol. Mass.444.489
SMILESNS(=O)(=O)c1c(F)c(F)c(c(NC2CCCCCCC2)c1F)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a