Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM50031588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441639
Kd 95±n/a nM
Citation Dudutiene, VMatuliene, JSmirnov, ATimm, DDZubriene, ABaranauskiene, LMorkunaite, VSmirnoviene, JMichailoviene, VJuozapaitiene, VMickeviciute, AKazokaite, JBak?yte, SKasiliauskaite, AJachno, JRevuckiene, JKi?onaite, MPilipuityte, VIvanauskaite, EMilinaviciute, GSmirnovas, VPetrikaite, VKairys, VPetrauskas, VNorvai?as, PLinge, DGibie?a, PCapkauskaite, EZak?auskas, AKazlauskas, EManakova, EGra?ulis, SLadbury, JEMatulis, D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031588
NameBDBM50031588
Synonyms:CHEMBL3359181
TypeSmall organic molecule
Emp. Form.C16H23F3N2O5S2
Mol. Mass.444.489
SMILESNS(=O)(=O)c1c(F)c(F)c(c(NC2CCCCCCC2)c1F)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a