Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM50031588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441658
Kd<10.0±n/a nM
Citation Dudutiene, VMatuliene, JSmirnov, ATimm, DDZubriene, ABaranauskiene, LMorkunaite, VSmirnoviene, JMichailoviene, VJuozapaitiene, VMickeviciute, AKazokaite, JBak?yte, SKasiliauskaite, AJachno, JRevuckiene, JKi?onaite, MPilipuityte, VIvanauskaite, EMilinaviciute, GSmirnovas, VPetrikaite, VKairys, VPetrauskas, VNorvai?as, PLinge, DGibie?a, PCapkauskaite, EZak?auskas, AKazlauskas, EManakova, EGra?ulis, SLadbury, JEMatulis, D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031588
NameBDBM50031588
Synonyms:CHEMBL3359181
TypeSmall organic molecule
Emp. Form.C16H23F3N2O5S2
Mol. Mass.444.489
SMILESNS(=O)(=O)c1c(F)c(F)c(c(NC2CCCCCCC2)c1F)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a