Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50429899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441647
Kd<10.0±n/a nM
Citation Dudutiene, VMatuliene, JSmirnov, ATimm, DDZubriene, ABaranauskiene, LMorkunaite, VSmirnoviene, JMichailoviene, VJuozapaitiene, VMickeviciute, AKazokaite, JBak?yte, SKasiliauskaite, AJachno, JRevuckiene, JKi?onaite, MPilipuityte, VIvanauskaite, EMilinaviciute, GSmirnovas, VPetrikaite, VKairys, VPetrauskas, VNorvai?as, PLinge, DGibie?a, PCapkauskaite, EZak?auskas, AKazlauskas, EManakova, EGra?ulis, SLadbury, JEMatulis, D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429899
NameBDBM50429899
Synonyms:CHEMBL2333416
TypeSmall organic molecule
Emp. Form.C8H7F4NO3S2
Mol. Mass.305.27
SMILESNS(=O)(=O)c1c(F)c(F)c(SCCO)c(F)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a