Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 22
LigandBDBM50031910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437898
Ki 10340±n/a nM
Citation Hou, XLi, RLi, KYu, XSun, JPFang, H Fast identification of novel lymphoid tyrosine phosphatase inhibitors using target-ligand interaction-based virtual screening. J Med Chem57:9309-22 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 22
Name:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
Synonyms:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP | LyP | Lymphoid phosphatase | Lymphoid phosphatase (Lyp) | PEP | PEST-domain phosphatase | PTPN22 | PTPN8 | Tyrosine-protein phosphatase non-receptor type 22 (LYP) | tyrosine-protein phosphatase non-receptor type 22 isoform 1
Type:n/a
Mol. Mass.:91712.31
Organism:Homo sapiens (Human)
Description:Q9Y2R2
Residue:807
Sequence:
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031910
NameBDBM50031910
Synonyms:CHEMBL3360908
TypeSmall organic molecule
Emp. Form.C20H17IN2O5
Mol. Mass.492.2639
SMILESCCN1C(=O)N\C(=C\c2ccc(OCc3ccc(cc3)C(O)=O)c(I)c2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a