Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 1
LigandBDBM50040744
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444377
IC50<100±n/a nM
Citation Chaudhary, DRobinson, SRomero, DL Recent advances in the discovery of small molecule inhibitors of interleukin-1 receptor-associated kinase 4 (IRAK4) as a therapeutic target for inflammation and oncology disorders. J Med Chem58:96-110 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 1
Name:Interleukin-1 receptor-associated kinase 1
Synonyms:IRAK | IRAK-1 | IRAK1 | Interleukin-1 receptor-associated kinase 1 (IRAK-1)
Type:Enzyme
Mol. Mass.:76536.81
Organism:Homo sapiens (Human)
Description:P51617
Residue:712
Sequence:
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040744
NameBDBM50040744
Synonyms:CHEMBL3353213
TypeSmall organic molecule
Emp. Form.C25H20N6O3
Mol. Mass.452.4647
SMILESOCc1ccc2nc(NC(=O)c3cccc(Cn4nc(ccc4=O)-c4cccnc4)c3)[nH]c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a