Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-aspartate oxidase 2
LigandBDBM50040959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444755
EC50>100000±n/a nM
Citation Yamamuro, DUchida, ROhtawa, MArima, SFutamura, YKatane, MHomma, HNagamitsu, TOsada, HTomoda, H Synthesis and biological activity of 5-(4-methoxyphenyl)-oxazole derivatives. Bioorg Med Chem Lett25:313-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-aspartate oxidase 2
Name:D-aspartate oxidase 2
Synonyms:D-aspartate oxidase 2 | DASOX 2 | DDO-2 | ddo-2
Type:PROTEIN
Mol. Mass.:37615.84
Organism:Caenorhabditis elegans
Description:ChEMBL_109533
Residue:334
Sequence:
MANIIPKIAIIGEGVIGCTSALQISKAIPNAKITVLHDKPFKKSCSAGPAGLFRIDYEEN
TEYGRASFAWFSHLYRTTKGSETGVKLVSGHIQSDNLESLKQQQRAYGDIVYNFRFLDDR
ERLDIFPEPSKHCIHYTAYASEGNKYVPYLKNLLLEQKIEFKQQEVTSLDAVADAGYDVI
VNCAGLYGGKLAGDDDTCYPIRGVILEVDAPWHKHFNYRDFTTFTIPKEHSVVVGSTKQD
NRWDLEITDEDRNDILKRYIALHPGMREPKIIKEWSALRPGRKHVRIEAQKRTSVGNSKD
YMVVHHYGHGSNGFTLGWGTAIEATKLVKTALGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040959
NameBDBM50040959
Synonyms:CHEMBL3354466
TypeSmall organic molecule
Emp. Form.C9H7NO2
Mol. Mass.161.1574
SMILESOc1ccc(cc1)-c1cnco1
Structure
n/a