Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-aspartate oxidase 1
LigandBDBM50040958
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444756
EC50>100000±n/a nM
Citation Yamamuro, DUchida, ROhtawa, MArima, SFutamura, YKatane, MHomma, HNagamitsu, TOsada, HTomoda, H Synthesis and biological activity of 5-(4-methoxyphenyl)-oxazole derivatives. Bioorg Med Chem Lett25:313-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-aspartate oxidase 1
Name:D-aspartate oxidase 1
Synonyms:D-aspartate oxidase 1 | DASOX 1 | DDO-1 | ddo-1
Type:PROTEIN
Mol. Mass.:37643.85
Organism:Caenorhabditis elegans
Description:ChEMBL_109534
Residue:334
Sequence:
MTPKIAIIGEGVIGCSTALQVAQAVPDARVTVLSDRPFEQTCSFGPAGLFRIDDIANREF
GKSTFDWFAHLHRTEKGDKTGVKLLSGHIQSDSKERLEQQQKAYGDIVYNFRFLEKREIL
DLFPNPSEHCIHYTAFASEGNKYVPYLKFQCQARGVEFLHRKVRDLEELANEGYDVIVNC
AGLSGGTLAGDDDSVYPIRGVVLDVEAHWHKHFNYKDFITFTIPKENSVVIGSVKQENRW
DLEITDVDRKDILERYVALHPAMREPKILGEWSGLRPARKTIRIEKVEKKSEKSGKKYTV
VHHYGHGGNGFTLGWGTAVEATKLVKSALNSSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040958
NameBDBM50040958
Synonyms:CHEMBL3354461
TypeSmall organic molecule
Emp. Form.C10H9NO2
Mol. Mass.175.184
SMILESCOc1ccc(cc1)-c1cnco1
Structure
n/a