Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTG 1019
LigandBDBM50046281
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1447591
IC50 460±n/a nM
Citation Gore, VChourey, SYe, QPatel, POuedraogo, YGravel, SPowell, WSRokach, J Base-dependent formation of cis and trans olefins and their application in the synthesis of 5-oxo-ETE receptor antagonists. Bioorg Med Chem Lett24:3385-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TG 1019
Name:TG 1019
Synonyms:5-oxo-ETE G-protein coupled receptor | G-protein coupled receptor 170 | G-protein coupled receptor R527 | G-protein coupled receptor TG1019 | Oxoeicosanoid receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:45833.20
Organism:HUMAN
Description:TG 1019 0 HUMAN::Q8TDS5
Residue:423
Sequence:
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046281
NameBDBM50046281
Synonyms:CHEMBL3311230
TypeSmall organic molecule
Emp. Form.C20H24ClNO3
Mol. Mass.361.862
SMILESCCCC\C=C/c1cc2ccc(Cl)cc2n1C(=O)CC(C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a