Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
LigandBDBM50046815
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1452800
IC50 494000±n/a nM
Citation Perdih, AHrast, MBarreteau, HGobec, SWolber, GSolmajer, T Benzene-1,3-dicarboxylic acid 2,5-dimethylpyrrole derivatives as multiple inhibitors of bacterial Mur ligases (MurC-MurF). Bioorg Med Chem22:4124-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Name:UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Synonyms:JW0083 | Meso-A2pm-adding enzyme | Meso-diaminopimelate-adding enzyme | UDP-MurNAc-L-Ala-D-Glu:meso-diaminopimelate ligase | UDP-MurNAc-tripeptide synthetase | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase | UDP-N-acetylmuramyl-tripeptide synthetase | murE
Type:PROTEIN
Mol. Mass.:53333.42
Organism:Escherichia coli (strain K12)
Description:ChEMBL_109170
Residue:495
Sequence:
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046815
n/a
NameBDBM50046815
Synonyms:CHEMBL3310461
TypeSmall organic molecule
Emp. Form.C24H19N3O5S
Mol. Mass.461.49
SMILESCc1cc(\C=C2\S\C(NC2=O)=N\c2ccccc2)c(C)n1-c1cc(cc(c1)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: