Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine Oxidase Type B (MAO-B)
LigandBDBM50046859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453693
IC50 2670±n/a nM
Citation Tzvetkov, NTHinz, SKüppers, PGastreich, MMüller, CE Indazole- and indole-5-carboxamides: selective and reversible monoamine oxidase B inhibitors with subnanomolar potency. J Med Chem57:6679-703 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine Oxidase Type B (MAO-B)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) B | Amine oxidase [flavin-containing] B | MAOB | Monoamine oxidase | Monoamine oxidase B (MAO-B) | Monoamine oxidase B (rMAO-B) | Monoamine oxidase type B (MAOB) | Monoamine oxidase-B (MAO-B)
Type:Enzyme
Mol. Mass.:58469.65
Organism:Rattus norvegicus (rat)
Description:P19643
Residue:520
Sequence:
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDGSCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046859
NameBDBM50046859
Synonyms:CHEMBL3319261
TypeSmall organic molecule
Emp. Form.C14H9ClFN3O
Mol. Mass.289.692
SMILESFc1cc(NC(=O)c2ccc3cn[nH]c3c2)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a