Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50046878
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453692
IC50 0.668000±n/a nM
Citation Tzvetkov, NTHinz, SKüppers, PGastreich, MMüller, CE Indazole- and indole-5-carboxamides: selective and reversible monoamine oxidase B inhibitors with subnanomolar potency. J Med Chem57:6679-703 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Monoamine oxidase
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046878
NameBDBM50046878
Synonyms:CHEMBL3319247
TypeSmall organic molecule
Emp. Form.C14H9ClFN3O
Mol. Mass.289.692
SMILESFc1cc(NC(=O)c2ccc3[nH]ncc3c2)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a