Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol lipase ABHD6
LigandBDBM50048618
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1449476
Ki 2700±n/a nM
Citation Janssen, FJDeng, HBaggelaar, MPAllarÓ, Mvan der Wel, Tden Dulk, HLigresti, Avan Esbroeck, ACMcGuire, RDi Marzo, VOverkleeft, HSvan der Stelt, M Discovery of glycine sulfonamides as dual inhibitors of sn-1-diacylglycerol lipasea anda/▀-hydrolase domain 6. J Med Chem57:6610-22 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol lipase ABHD6
Name:Monoacylglycerol lipase ABHD6
Synonyms:2-arachidonoylglycerol hydrolase | ABHD6 | Abhydrolase domain-containing protein 6 | Monoacylglycerol lipase ABHD6
Type:PROTEIN
Mol. Mass.:38341.83
Organism:Homo sapiens
Description:ChEMBL_105457
Residue:337
Sequence:
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048618
NameBDBM50048618
Synonyms:CHEMBL3319622
TypeSmall organic molecule
Emp. Form.C26H25F3N2O6S
Mol. Mass.550.547
SMILESCC1(C)CCc2cc(ccc2O1)S(=O)(=O)N(CC(O)=O)Cc1ccc(Oc2ccc(cn2)C(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a