Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium channel protein TASK-1
LigandBDBM50312105
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1457501
IC50 16±n/a nM
Citation Flaherty, DPSimpson, DSMiller, MMaki, BEZou, BShi, JWu, MMcManus, OBAubé, JLi, MGolden, JE Potent and selective inhibitors of the TASK-1 potassium channel through chemical optimization of a bis-amide scaffold. Bioorg Med Chem Lett24:3968-73 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium channel protein TASK-1
Name:Potassium channel protein TASK-1
Synonyms:Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1
Type:Protein
Mol. Mass.:43534.71
Organism:Homo sapiens (Human)
Description:O14649
Residue:394
Sequence:
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312105
NameBDBM50312105
Synonyms:2-methoxy-N-(3-(3-methylbenzamido)phenyl)benzamide | CHEMBL1081188
TypeSmall organic molecule
Emp. Form.C22H20N2O3
Mol. Mass.360.4058
SMILESCOc1ccccc1C(=O)Nc1cccc(NC(=O)c2cccc(C)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a