Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic elongation factor 2 kinase
LigandBDBM50053577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1446963
IC50 1000±n/a nM
Citation Edupuganti, RWang, QTavares, CDChitjian, CABachman, JLRen, PAnslyn, EVDalby, KN Synthesis and biological evaluation of pyrido[2,3-d]pyrimidine-2,4-dione derivatives as eEF-2K inhibitors. Bioorg Med Chem22:4910-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic elongation factor 2 kinase
Name:Eukaryotic elongation factor 2 kinase
Synonyms:Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase | EEF2K | Eukaryotic elongation factor 2 kinase (EEF2K) | Eukaryotic elongation factor 2 kinase (eEF-2K) | eEF-2 kinase | eEF-2K
Type:Protein
Mol. Mass.:82116.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:725
Sequence:
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053577
NameBDBM50053577
Synonyms:CHEMBL3326370
TypeSmall organic molecule
Emp. Form.C12H15N5O3
Mol. Mass.277.2792
SMILESCCn1c2nc(N)c(cc2c(=O)n(CC)c1=O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a