Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50054344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1458327
IC50 2340±n/a nM
Citation Zeng, LFZhang, RYYu, ZHLi, SWu, LGunawan, AMLane, BSMali, RSLi, XChan, RJKapur, RWells, CDZhang, ZY Therapeutic potential of targeting the oncogenic SHP2 phosphatase. J Med Chem57:6594-609 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054344
NameBDBM50054344
Synonyms:CHEMBL3319356 | US9522881, 11a-1 L97M74
TypeSmall organic molecule
Emp. Form.C28H20IN3O5S
Mol. Mass.637.445
SMILESCn1c(c(I)c2cc(C(O)=O)c(O)cc12)-c1cccc(NC(=O)C(=O)Nc2ccc(cc2)-c2ccsc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a