Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase 23 (VHZ)
LigandBDBM50054344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1458328
IC50 2300±n/a nM
Citation Zeng, LFZhang, RYYu, ZHLi, SWu, LGunawan, AMLane, BSMali, RSLi, XChan, RJKapur, RWells, CDZhang, ZY Therapeutic potential of targeting the oncogenic SHP2 phosphatase. J Med Chem57:6594-609 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein phosphatase 23 (VHZ)
Name:Dual specificity protein phosphatase 23 (VHZ)
Synonyms:DUSP23 | Dual specificity protein phosphatase 23 | LDP-3 | LDP3 | Low molecular mass dual specificity phosphatase 3 | VH1-like phosphatase Z | VHZ
Type:Enzyme
Mol. Mass.:16592.49
Organism:Homo sapiens (Human)
Description:Q9BVJ7
Residue:150
Sequence:
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054344
NameBDBM50054344
Synonyms:CHEMBL3319356 | US9522881, 11a-1 L97M74 | US9844535, ID 11a-1 L97M74
TypeSmall organic molecule
Emp. Form.C28H20IN3O5S
Mol. Mass.637.445
SMILESCn1c(c(I)c2cc(C(O)=O)c(O)cc12)-c1cccc(NC(=O)C(=O)Nc2ccc(cc2)-c2ccsc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a