Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen phosphorylase, muscle form
LigandBDBM50056265
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1449753
Ki 61000±n/a nM
Citation Parmenopoulou, VKantsadi, ALTsirkone, VGChatzileontiadou, DSManta, SZographos, SEMolfeta, CArchontis, GAgius, LHayes, JMLeonidas, DDKomiotis, D Structure based inhibitor design targeting glycogen phosphorylase B. Virtual screening, synthesis, biochemical and biological assessment of novel N-acyl--d-glucopyranosylamines. Bioorg Med Chem22:4810-25 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen phosphorylase, muscle form
Name:Glycogen phosphorylase, muscle form
Synonyms:Glycogen Phosphorylase (PYGM) | Glycogen phosphorylase a (RMGPa) | Myophosphorylase
Type:Enzyme
Mol. Mass.:97296.32
Organism:Oryctolagus cuniculus (rabbit)
Description:Phosphorylation of Ser-15 converts phosphorylase B (unphosphorylated) to phosphorylase A.
Residue:843
Sequence:
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERL
DWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVV
PRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEE
YVKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
KIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056265
NameBDBM50056265
Synonyms:CHEMBL3322307
TypeSmall organic molecule
Emp. Form.C15H17NO6
Mol. Mass.307.2986
SMILESOC[C@H]1O[C@@H](NC(=O)C#Cc2ccccc2)[C@H](O)[C@@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a