Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type I
LigandBDBM50056511
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453216
IC50 12300±n/a nM
Citation Mohedas, AHWang, YSanvitale, CECanning, PChoi, SXing, XBullock, ANCuny, GDYu, PB Structure-activity relationship of 3,5-diaryl-2-aminopyridine ALK2 inhibitors reveals unaltered binding affinity for fibrodysplasia ossificans progressiva causing mutants. J Med Chem57:7900-15 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type I
Name:TGF-beta receptor type I
Synonyms:2.7.11.30 | ALK-5 | ALK5
Type:n/a
Mol. Mass.:55968.24
Organism:Homo sapiens (Human)
Description:P36897
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056511
NameBDBM50056511
Synonyms:CHEMBL3341948
TypeSmall organic molecule
Emp. Form.C22H24N4O
Mol. Mass.360.4522
SMILESCOc1cccc(c1)-c1cc(cnc1N)-c1ccc(cc1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a