Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcPLA2 C2
LigandBDBM50056708
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1454057
IC50 15±n/a nM
Citation Tomoo, TNakatsuka, TKatayama, THayashi, YFujieda, YTerakawa, MNagahira, K Design, synthesis, and biological evaluation of 3-(1-Aryl-1H-indol-5-yl)propanoic acids as new indole-based cytosolic phospholipase A2a inhibitors. J Med Chem57:7244-62 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cPLA2 C2
Name:Cytosolic phospholipase A2
Synonyms:Cytosolic phospholipase A2 | Lysophospholipase | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 | Phospholipase A2 group IVA | cPLA2
Type:Protein
Mol. Mass.:85219.30
Organism:Homo sapiens (Human)
Description:P47712
Residue:749
Sequence:
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056708
NameBDBM50056708
Synonyms:CHEMBL3326970
TypeSmall organic molecule
Emp. Form.C31H38N2O6
Mol. Mass.534.6432
SMILESNC(CO)(CO)CO.CCOc1ccc(cc1)-n1cc(CCc2ccccc2)c2cc(CCC(O)=O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a