Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50068025
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463748
IC50 45±n/a nM
Citation Engelbrecht, IPetzer, JPPetzer, A The synthesis and evaluation of sesamol and benzodioxane derivatives as inhibitors of monoamine oxidase. Bioorg Med Chem Lett25:1896-900 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Amine oxidase [flavin-containing] B
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068025
NameBDBM50068025
Synonyms:CHEMBL3402197
TypeSmall organic molecule
Emp. Form.C15H13BrO3
Mol. Mass.321.166
SMILESBrc1cccc(COc2ccc3OCCOc3c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a