Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] A
LigandBDBM50068024
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463746
IC50 13200±n/a nM
Citation Engelbrecht, IPetzer, JPPetzer, A The synthesis and evaluation of sesamol and benzodioxane derivatives as inhibitors of monoamine oxidase. Bioorg Med Chem Lett25:1896-900 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] A
Name:Amine oxidase [flavin-containing] A
Synonyms:Amine oxidase (flavin-containing) A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068024
NameBDBM50068024
Synonyms:CHEMBL3402196
TypeSmall organic molecule
Emp. Form.C15H13ClO3
Mol. Mass.276.715
SMILESClc1cccc(COc2ccc3OCCOc3c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a