Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50389135
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1469765
Ki 0.580000±n/a nM
Citation Tosh, DKFinley, APaoletta, SMoss, SMGao, ZGGizewski, ETAuchampach, JASalvemini, DJacobson, KA In vivo phenotypic screening for treating chronic neuropathic pain: modification of C2-arylethynyl group of conformationally constrained A3 adenosine receptor agonists. J Med Chem57:9901-14 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50389135
NameBDBM50389135
Synonyms:CHEMBL2064640
TypeSmall organic molecule
Emp. Form.C22H21ClN6O3
Mol. Mass.452.894
SMILESCNC(=O)[C@@]12C[C@@H]1[C@H]([C@H](O)[C@@H]2O)n1cnc2c(NC)nc(nc12)C#Cc1ccccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a