Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKrueppel-like factor 10
LigandBDBM50108877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467056
IC50 50000±n/a nM
Citation Khedkar, SASun, XRigby, ACFeinberg, MW Discovery of small molecule inhibitors to Krüppel-like factor 10 (KLF10): implications for modulation of T regulatory cell differentiation. J Med Chem58:1466-78 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Krueppel-like factor 10
Name:Krueppel-like factor 10
Synonyms:EGR-alpha | KLF10 | Krueppel-like factor 10 | TGFB-inducible early growth response protein 1 | TIEG | TIEG-1 | TIEG1 | Transforming growth factor-beta-inducible early growth response protein 1
Type:PROTEIN
Mol. Mass.:52579.81
Organism:Homo sapiens (Human)
Description:ChEMBL_109571
Residue:480
Sequence:
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYV
ENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFK
SLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNY
QNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVI
CRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQ
IDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108877
NameBDBM50108877
Synonyms:(3,4-Dihydroxy-5-nitro-phenyl)-p-tolyl-methanone | (3,4-dihydroxy-5-nitrophenyl)(p-tolyl)methanone | CHEMBL1324 | Ro-40-7592 | TOLCAPONE | Talcapone | Tasmar
TypeSmall organic molecule
Emp. Form.C14H11NO5
Mol. Mass.273.2408
SMILESCc1ccc(cc1)C(=O)c1cc(O)c(O)c(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a