Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50072662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467118
IC50 4000±n/a nM
Citation Yin, YZheng, KEid, NHoward, SJeong, JHYi, FGuo, JPark, CMBibian, MWu, WHernandez, PPark, HWu, YLuo, JLLoGrasso, PVFeng, Y Bis-aryl urea derivatives as potent and selective LIM kinase (Limk) inhibitors. J Med Chem58:1846-61 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:LIM domain kinase 1 | LIMK-1 | Limk | Limk1
Type:PROTEIN
Mol. Mass.:72598.76
Organism:Rattus norvegicus
Description:ChEMBL_109573
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCSQSIYDGQYLQALNADWHADCFRCCECSTSLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVGGELKYHPECFICLACGNFIGD
GDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHIGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLASPVHTPSGQAGSSARQKPVLRSCSID
TSPGAGSLVSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFG
LARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072662
NameBDBM50072662
Synonyms:CHEMBL3407526
TypeSmall organic molecule
Emp. Form.C24H23FN6O2
Mol. Mass.446.4768
SMILESCC(C)NC(=O)c1cccc(NC(=O)Nc2ccc(cc2F)-c2ncnc3[nH]cc(C)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a