Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM36510
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467358
IC50 920±n/a nM
Citation Gritzalis, DPark, JChiu, WCho, HLin, YSDe Schutter, JWLacbay, CMZielinski, MBerghuis, AMTsantrizos, YS Probing the molecular and structural elements of ligands binding to the active site versus an allosteric pocket of the human farnesyl pyrophosphate synthase. Bioorg Med Chem Lett25:1117-23 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36510
NameBDBM36510
Synonyms:1-(Carboxymethyl)-1H-benzo[g]indole-2-carboxylic acid, 11 | CID46398840
TypeSmall organic molecule
Emp. Form.C15H11NO4
Mol. Mass.269.2521
SMILESOC(=O)Cn1c(cc2ccc3ccccc3c12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a