Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinal dehydrogenase 2
LigandBDBM50076552
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1473077
IC50>100000±n/a nM
Citation Morgan, CAHurley, TD Characterization of two distinct structural classes of selective aldehyde dehydrogenase 1A1 inhibitors. J Med Chem58:1964-75 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinal dehydrogenase 2
Name:Retinal dehydrogenase 2
Synonyms:ALDH1A2 | Aldehyde dehydrogenase family 1 member A2 | RALDH 2 | RALDH(II) | RALDH2 | RalDH2 | Retinal dehydrogenase 2 | Retinaldehyde-specific dehydrogenase type 2
Type:PROTEIN
Mol. Mass.:56720.77
Organism:Homo sapiens (Human)
Description:ChEMBL_109700
Residue:518
Sequence:
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076552
NameBDBM50076552
Synonyms:CHEMBL1311611
TypeSmall organic molecule
Emp. Form.C21H29N5O2
Mol. Mass.383.4873
SMILESCC(C)CCn1c(CN(C)Cc2ccccc2)nc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a