Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
LigandBDBM50079625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1472394
IC50>20000±n/a nM
Citation Ekblad, TLindgren, AEAndersson, CDCaraballo, RThorsell, AGKarlberg, TSpjut, SLinusson, ASchüler, HElofsson, M Towards small molecule inhibitors of mono-ADP-ribosyltransferases. Eur J Med Chem95:546-51 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Synonyms:(ARTD7 or PARP15) | (ARTD7 or PARP15, Y598L) | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 7 | ARTD7 | B-aggressive lymphoma protein 3 | BAL3 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15, Y598L) | PARP-15 | PARP15 | Poly [ADP-ribose] polymerase 15
Type:n/a
Mol. Mass.:74595.89
Organism:Homo sapiens (Human)
Description:Q460N3
Residue:678
Sequence:
MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSR
SMSRDNKFSKKDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGP
LSRAFLQKAGPMLQKELDDRRRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSW
QIMANIIKKCLTTVEVLSFSSITFPMIGTGSLQFPKAVFAKLILSEVFEYSSSTRPITSP
LQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAGDTQGVVGTVSKPCFTAYEMK
IGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESECAVLAAQPHR
DFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTC
NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVK
KRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSA
KDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLF
VVFFDNQAYPEYLITFTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079625
NameBDBM50079625
Synonyms:CHEMBL3414770
TypeSmall organic molecule
Emp. Form.C12H14N2O4
Mol. Mass.250.2506
SMILESNC(=O)c1cccc(NC(=O)CCCC(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a