Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase-related protein 1
LigandBDBM50080537
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475204
IC50 68440±n/a nM
Citation Stefek, MSoltesova Prnova, MMajekova, MRechlin, CHeine, AKlebe, G Identification of novel aldose reductase inhibitors based on carboxymethylated mercaptotriazinoindole scaffold. J Med Chem58:2649-57 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase-related protein 1
Name:Aldose reductase-related protein 1
Synonyms:Akr1b14 | Akr1b7 | Aldehyde reductase | Aldo-keto reductase family 1 member B7 | Aldose reductase-like protein AKR1B14 | Aldose reductase-related protein 1
Type:PROTEIN
Mol. Mass.:36127.39
Organism:Rattus norvegicus
Description:ChEMBL_109605
Residue:316
Sequence:
MTTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQ
EKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGK
EFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKP
VTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAK
HKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACG
LFVTSDEEDFPFHEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080537
NameBDBM50080537
Synonyms:CHEMBL1337856
TypeSmall organic molecule
Emp. Form.C15H17NO3
Mol. Mass.259.3004
SMILESCC(C)(C)C(=O)c1cn(CC(O)=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a