Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase 23 (VHZ)
LigandBDBM50087856
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476070
pH7±n/a
IC50 11400±n/a nM
Commentsextracted
Citation He, YGuo, XYu, ZHWu, LGunawan, AMZhang, YDixon, JEZhang, ZY A potent and selective inhibitor for the UBLCP1 proteasome phosphatase. Bioorg Med Chem23:2798-809 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein phosphatase 23 (VHZ)
Name:Dual specificity protein phosphatase 23 (VHZ)
Synonyms:DUSP23 | Dual specificity protein phosphatase 23 | LDP-3 | LDP3 | Low molecular mass dual specificity phosphatase 3 | VH1-like phosphatase Z | VHZ
Type:Enzyme
Mol. Mass.:16592.49
Organism:Homo sapiens (Human)
Description:Q9BVJ7
Residue:150
Sequence:
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087856
NameBDBM50087856
Synonyms:CHEMBL3426913
TypeSmall organic molecule
Emp. Form.C28H30F3NO6
Mol. Mass.533.5361
SMILESCCCCC(Oc1cc(O)c(cc1C#Cc1ccccc1OC(F)(F)F)C(O)=O)C(=O)NC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a