Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50104677
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476527
IC50 2500±n/a nM
Citation Carneiro, VMTrivella, DBScorsato, VBeraldo, VLDias, MPSobreira, TJAparicio, RPilli, RA Is RK-682 a promiscuous enzyme inhibitor? Synthesis and in vitro evaluation of protein tyrosine phosphatase inhibition of racemic RK-682 and analogues. Eur J Med Chem97:42-54 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104677
NameBDBM50104677
Synonyms:3-Hexadecanoyl-4-hydroxy-5-methylene-5H-furan-2-one | CHEMBL110642
TypeSmall organic molecule
Emp. Form.C21H34O4
Mol. Mass.350.4923
SMILESCCCCCCCCCCCCCCCC(=O)C1C(=O)OC(=C)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a