Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA (cytosine-5)-methyltransferase 3B
LigandBDBM50009672
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1496153
IC50>50000±n/a nM
Citation Smil, DEram, MSLi, FKennedy, SSzewczyk, MMBrown, PJBarsyte-Lovejoy, DArrowsmith, CHVedadi, MSchapira, M Discovery of a Dual PRMT5-PRMT7 Inhibitor. ACS Med Chem Lett6:408-12 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA (cytosine-5)-methyltransferase 3B
Name:DNA (cytosine-5)-methyltransferase 3B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:95771.12
Organism:Homo sapiens (Human)
Description:ChEMBL_1473708
Residue:853
Sequence:
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREV
SSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPS
PRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWP
AMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRK
AMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKS
KVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTV
CCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRK
DWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGK
YVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPA
RKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVM
IDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNS
IKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009672
NameBDBM50009672
Synonyms:AdoHcy | CHEMBL418052 | S-(5'-adenosyl)-L-homocysteine | S-(5'-deoxyadenosin-5'-yl)-L-homocysteine | S-[1-(adenin-9-yl)-1,5-dideoxy-beta-D-ribofuranos-5-yl]-L-homocysteine | S-adenosyl-L-homocysteine | SAH | US8895245, S-Adenosyl-L-homocysteine (SAH) | US9175331, 1 | US9333217, S-Adenosyl-L-homocysteine (SAH)
TypeSmall organic molecule
Emp. Form.C14H20N6O5S
Mol. Mass.384.411
SMILESN[C@@H](CCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)C(O)=O
Structure
n/a