Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol acyltransferase type 2 (h-MGAT2)
LigandBDBM50090617
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498282
IC50 3.1±n/a nM
Citation Sato, KTakahagi, HYoshikawa, TMorimoto, STakai, THidaka, KKamaura, MKubo, OAdachi, RIshii, TMaki, TMochida, TTakekawa, SNakakariya, MAmano, NKitazaki, T Discovery of a Novel Series of N-Phenylindoline-5-sulfonamide Derivatives as Potent, Selective, and Orally Bioavailable Acyl CoA:Monoacylglycerol Acyltransferase-2 Inhibitors. J Med Chem58:3892-909 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Name:Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Synonyms:Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase | Beta-1,2-N-acetylglucosaminyltransferase II | GNT-II | GlcNAc-T II | MGAT2 | Mannoside acetylglucosaminyltransferase 2 | Monoacylglycerol acyltransferase 2 (MGAT2) | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II | h-MGAT2 (human monoacylglycerol acyltransferase type 2)
Type:n/a
Mol. Mass.:51567.80
Organism:Homo sapiens (Human)
Description:Q10469
Residue:447
Sequence:
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090617
NameBDBM50090617
Synonyms:CHEMBL3581734
TypeSmall organic molecule
Emp. Form.C26H21F5N4O4S
Mol. Mass.580.526
SMILESFc1ccc(NS(=O)(=O)c2cc3CCN(C(=O)Nc4ccc(cc4)C(F)(F)F)c3c(c2)N2CCCC2=O)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a