Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgrammed cell death 1 ligand 1
LigandBDBM50091331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1497759
IC50 101±n/a nM
Citation Abdel-Magid, AF Inhibitors of the PD-1/PD-L1 Pathway Can Mobilize the Immune System: An Innovative Potential Therapy for Cancer and Chronic Infections. ACS Med Chem Lett6:489-90 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Programmed cell death 1 ligand 1
Name:Programmed cell death 1 ligand 1
Synonyms:B7 homolog 1 | B7-H1 | B7H1 | CD274 | CD_antigen=CD274 | PD-L1 | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL1 | Programmed cell death 1 ligand 1 | Programmed death ligand 1
Type:PROTEIN
Mol. Mass.:33278.49
Organism:Homo sapiens
Description:ChEMBL_109807
Residue:290
Sequence:
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091331
NameBDBM50091331
Synonyms:CHEMBL3582255
TypeSmall organic molecule
Emp. Form.C26H28N2O2
Mol. Mass.400.5127
SMILESCc1c(COc2ccc(CNCC3CCC(=O)N3)cc2)cccc1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a