Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonocarboxylate transporter 1 (MCT1)
LigandBDBM50092075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498543
IC50 70±n/a nM
Citation Gurrapu, SJonnalagadda, SKAlam, MANelson, GLSneve, MGDrewes, LRMereddy, VR Monocarboxylate transporter 1 inhibitors as potential anticancer agents. ACS Med Chem Lett6:558-61 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monocarboxylate transporter 1 (MCT1)
Name:Monocarboxylate transporter 1 (MCT1)
Synonyms:MCT 1 | Mct1 | Monocarboxylate transporter 1 | Slc16a1 | Solute carrier family 16 member 1
Type:Enzyme
Mol. Mass.:53245.17
Organism:Rattus norvegicus (Rat)
Description:P53987
Residue:494
Sequence:
MPPAIGGPVGYTPPDGGWGWAVVVGAFISIGFSYAFPKSITVFFKEIEIIFSATTSEVSW
ISSIMLAVMYAGGPISSILVNKYGSRPVMIAGGCLSGCGLIAASFCNTVQELYFCIGVIG
GLGLAFNLNPALTMIGKYFYKKRPLANGLAMAGSPVFLSTLAPLNQAFFGIFGWRGSFLI
LGGLLLNCCVAGSLMRPIGPQQGKVEKLKSKESLQEAGKSDANTDLIGGSPKGEKLSVFQ
TVNKFLDLSLFTHRGFLLYLSGNVVMFFGLFTPLVFLSNYGKSKHFSSEKSAFLLSILAF
VDMVARPSMGLAANTRWIRPRVQYFFAASVVANGVCHLLAPLSTTYVGFCIYAGVFGFAF
GWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACG
VILIIAGLYLFIGMGINYRLVAKEQKAEEKKRDGKEDETSTDVDEKPKKTMKETQSPAPL
QNSSGDPAEEESPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092075
n/a
NameBDBM50092075
Synonyms:CHEMBL3582416 | US9296728, 11
TypeSmall organic molecule
Emp. Form.C14H14N2O2
Mol. Mass.242.2732
SMILESOC(=O)C(=C\c1ccc(cc1)N1CCCC1)\C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: