Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPM/ALK (Nucleophosmin/ALK tyrosine kinase receptor)
LigandBDBM50094238
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502715
EC50 2500±n/a nM
Citation Penthala, NRCrooks, PAFreeman, MLSekhar, KR Development and validation of a novel assay to identify radiosensitizers that target nucleophosmin 1. Bioorg Med Chem23:3681-6 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NPM/ALK (Nucleophosmin/ALK tyrosine kinase receptor)
Name:NPM/ALK (Nucleophosmin/ALK tyrosine kinase receptor)
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32552.99
Organism:Homo sapiens (Human)
Description:ChEMBL_1502715
Residue:294
Sequence:
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094238
NameBDBM50094238
Synonyms:CHEMBL3589689
TypeSmall organic molecule
Emp. Form.C21H16BrN3O2S
Mol. Mass.454.34
SMILES[#6]-c1c(\[#6]=[#6]-2/[#6](=O)-[#7]-[#6](=S)-[#7]-[#6]-2=O)c2ccccc2n1-[#6]-c1ccc(Br)cc1
Structure
n/a