Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental type
LigandBDBM50080274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1506090
Ki 580000±n/a nM
Citation Fonseca, EMTrivella, DBScorsato, VDias, MPBazzo, NLMandapati, KRde Oliveira, FLFerreira-Halder, CVPilli, RAMiranda, PCAparicio, R Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates. Bioorg Med Chem23:4462-71 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase placental type
Name:Alkaline phosphatase placental type
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:57950.65
Organism:Homo sapiens (Human)
Description:ChEMBL_1506090
Residue:535
Sequence:
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII
FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA
YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080274
NameBDBM50080274
Synonyms:Benzyl-phosphonic acid | CHEMBL299737 | Phenyl-methanephosphonic acid anion | benzylphosphonic acid
TypeSmall organic molecule
Emp. Form.C7H9O3P
Mol. Mass.172.1183
SMILESOP(O)(=O)Cc1ccccc1
Structure
n/a