Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 1
LigandBDBM50096279
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1495636
IC50 390±n/a nM
Citation Henry, JRKaufman, MDPeng, SBAhn, YMCaldwell, TMVogeti, LTelikepalli, HLu, WPHood, MMRutkoski, TJSmith, BDVogeti, SMiller, DWise, SCChun, LZhang, XZhang, YKays, LHipskind, PAWrobleski, ADLobb, KLClay, JMCohen, JDWalgren, JLMcCann, DPatel, PClawson, DKGuo, SManglicmot, DGroshong, CLogan, CStarling, JJFlynn, DL Discovery of 1-(3,3-dimethylbutyl)-3-(2-fluoro-4-methyl-5-(7-methyl-2-(methylamino)pyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (LY3009120) as a pan-RAF inhibitor with minimal paradoxical activation and activity against BRAF or RAS mutant tumor cells. J Med Chem58:4165-79 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 1
Name:Interleukin-1 receptor-associated kinase 1
Synonyms:IRAK | IRAK-1 | IRAK1 | Interleukin-1 receptor-associated kinase 1 (IRAK-1)
Type:Enzyme
Mol. Mass.:76536.81
Organism:Homo sapiens (Human)
Description:P51617
Residue:712
Sequence:
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096279
NameBDBM50096279
Synonyms:CHEMBL3577124
TypeSmall organic molecule
Emp. Form.C23H29FN6O
Mol. Mass.424.5144
SMILESCNc1ncc2cc(c(C)nc2n1)-c1cc(NC(=O)NCCC(C)(C)C)c(F)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a