Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TEC
LigandBDBM50097393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1501939
IC50 57±n/a nM
Citation Smith, CRDougan, DRKomandla, MKanouni, TKnight, BLawson, JDSabat, MTaylor, ERVu, PWyrick, C Fragment-Based Discovery of a Small Molecule Inhibitor of Bruton's Tyrosine Kinase. J Med Chem58:5437-44 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TEC
Name:Tyrosine-protein kinase TEC
Synonyms:TEC | Tyrosine-protein kinase TEC (TEC)
Type:Protein
Mol. Mass.:73597.00
Organism:Homo sapiens (Human)
Description:n/a
Residue:631
Sequence:
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097393
NameBDBM50097393
Synonyms:CHEMBL3586447
TypeSmall organic molecule
Emp. Form.C17H14N6O
Mol. Mass.318.3327
SMILESCc1cc2cn[nH]c2cc1-c1cccc2c(N)c(nnc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a