Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM50097393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1501946
IC50 67±n/a nM
Citation Smith, CRDougan, DRKomandla, MKanouni, TKnight, BLawson, JDSabat, MTaylor, ERVu, PWyrick, C Fragment-Based Discovery of a Small Molecule Inhibitor of Bruton's Tyrosine Kinase. J Med Chem58:5437-44 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097393
NameBDBM50097393
Synonyms:CHEMBL3586447
TypeSmall organic molecule
Emp. Form.C17H14N6O
Mol. Mass.318.3327
SMILESCc1cc2cn[nH]c2cc1-c1cccc2c(N)c(nnc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a