Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBetaine transporter
LigandBDBM50419338
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1454199
IC50 5100±n/a nM
Citation Kobayashi, TSuemasa, AIgawa, AIde, SFukuda, HAbe, HArisawa, MMinami, MShuto, S Conformationally Restricted GABA with Bicyclo[3.1.0]hexane Backbone as the First Highly Selective BGT-1 Inhibitor. ACS Med Chem Lett5:889-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Betaine transporter
Name:Betaine transporter
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:69366.52
Organism:Homo sapiens
Description:ChEMBL_1454199
Residue:614
Sequence:
MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVW
RFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGL
ASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTP
FENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVY
FTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQG
CLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGP
GLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGR
RELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADR
FYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGW
FLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSP
TREGLIAGEKETHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50419338
NameBDBM50419338
Synonyms:CHEMBL1446457
TypeSmall organic molecule
Emp. Form.C27H30N2O2
Mol. Mass.414.5393
SMILESCOc1ccccc1C1(O)CCN(CCCn2c3ccccc3c3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a