Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
LigandBDBM50104285
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1505402
IC50 17000±n/a nM
Citation Nkizinkiko, YSuneel Kumar, BVJeankumar, VUHaikarainen, TKoivunen, JMadhuri, CYogeeswari, PVenkannagari, HObaji, EPihlajaniemi, TSriram, DLehtiö, L Discovery of potent and selective nonplanar tankyrase inhibiting nicotinamide mimics. Bioorg Med Chem23:4139-49 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Synonyms:(ARTD7 or PARP15) | (ARTD7 or PARP15, Y598L) | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 7 | ARTD7 | B-aggressive lymphoma protein 3 | BAL3 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15, Y598L) | PARP-15 | PARP15 | Poly [ADP-ribose] polymerase 15
Type:n/a
Mol. Mass.:74595.89
Organism:Homo sapiens (Human)
Description:Q460N3
Residue:678
Sequence:
MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSR
SMSRDNKFSKKDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGP
LSRAFLQKAGPMLQKELDDRRRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSW
QIMANIIKKCLTTVEVLSFSSITFPMIGTGSLQFPKAVFAKLILSEVFEYSSSTRPITSP
LQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAGDTQGVVGTVSKPCFTAYEMK
IGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESECAVLAAQPHR
DFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTC
NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVK
KRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSA
KDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLF
VVFFDNQAYPEYLITFTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104285
NameBDBM50104285
Synonyms:CHEMBL3593716
TypeSmall organic molecule
Emp. Form.C13H20N4O
Mol. Mass.248.3241
SMILESCN1CCN(CC1)c1nc2CCCCc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a