Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor 2
LigandBDBM50072394
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1508580
IC50 7.0±n/a nM
Citation Meena, CLThakur, ANandekar, PPSangamwar, ATSharma, SSJain, R Synthesis of CNS active thyrotropin-releasing hormone (TRH)-like peptides: Biological evaluation and effect on cognitive impairment induced by cerebral ischemia in mice. Bioorg Med Chem23:5641-53 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor 2
Name:Thyrotropin-releasing hormone receptor 2
Synonyms:TRH-R2 | Thyrotropin-releasing hormone receptor 2
Type:PROTEIN
Mol. Mass.:27545.04
Organism:Mus musculus
Description:ChEMBL_109850
Residue:251
Sequence:
MDGPSNVSLVHGDTTLGLPEYKVVSVLLVLLVCTVGIVGNAMVVLVVLTSRDMHTPTNCY
LVSLALADLIVLLAAGLPNVSDSLVGHWIYGHAGCLGITYFQYLGINVSSCSILAFTVER
YIAICHPMRAQTVCTVARARRIIAGIWGVTSLYCLLWFFLVDLNVRDNQRLECGYKVSRG
LYLPIYLLDFAVFFIAPLLGTLVLYGFIGRILFQSPLSQEAWQKERQSHGQSEGTPGNCS
RSKSSMSSRKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072394
n/a
NameBDBM50072394
Synonyms:1-[3-(1H-4-imidazolyl)-2-(5-oxotetrahydro-1H-2-pyrrolylcarboxamido)propanoyl]tetrahydro-1H-2-pyrrolecarboxamide | A-38579 | ABBOTT-38579 | PROTIRELIN
TypeSmall organic molecule
Emp. Form.C16H22N6O4
Mol. Mass.362.3837
SMILESNC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCC(=O)N1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: