Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMineralocorticoid receptor
LigandBDBM50110736
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1510384
Ki 27±n/a nM
Citation Luz, JGCarson, MWCondon, BClawson, DPustilnik, AKohlman, DTBarr, RJBean, JSDill, MJSindelar, DKMaletic, MCoghlan, MJ Indole Glucocorticoid Receptor Antagonists Active in a Model of Dyslipidemia Act via a Unique Association with an Agonist Binding Site. J Med Chem58:6607-18 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mineralocorticoid receptor
Name:Mineralocorticoid receptor
Synonyms:MLR | MR | NR3C2 | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme
Mol. Mass.:107076.42
Organism:Homo sapiens (Human)
Description:P08235
Residue:984
Sequence:
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAI
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
AENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110736
NameBDBM50110736
Synonyms:CHEMBL3605933
TypeSmall organic molecule
Emp. Form.C16H16N2O3S
Mol. Mass.316.375
SMILESCOc1ccccc1-c1c[nH]c2c(NS(C)(=O)=O)cccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a