Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol lipase ABHD6
LigandBDBM50118169
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1514730
IC50 130±n/a nM
Citation Patel, JZvan Bruchem, JLaitinen, TKaczor, AANavia-Paldanius, DParkkari, TSavinainen, JRLaitinen, JTNevalainen, TJ Revisiting 1,3,4-Oxadiazol-2-ones: Utilization in the Development of ABHD6 Inhibitors. Bioorg Med Chem23:6335-45 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol lipase ABHD6
Name:Monoacylglycerol lipase ABHD6
Synonyms:2-arachidonoylglycerol hydrolase | ABHD6 | Abhydrolase domain-containing protein 6 | Monoacylglycerol lipase ABHD6
Type:PROTEIN
Mol. Mass.:38341.83
Organism:Homo sapiens
Description:ChEMBL_105457
Residue:337
Sequence:
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118169
NameBDBM50118169
Synonyms:CHEMBL3613161
TypeSmall organic molecule
Emp. Form.C15H11N3O5
Mol. Mass.313.2649
SMILES[O-][N+](=O)c1cccc(Cn2nc(Oc3ccccc3)oc2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a