Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
LigandBDBM50116357
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1511512
Ki 4.5±n/a nM
Citation Evans, GBCameron, SALuxenburger, AGuan, RSuarez, JThomas, KSchramm, VLTyler, PC Tight binding enantiomers of pre-clinical drug candidates. Bioorg Med Chem23:5326-33 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
Name:5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
Synonyms:5''-methylthioadenosine nucleosidase | 5''-methylthioadenosine/S-adenosylhomocysteine nucleosidase | ACN002_0164 | APZ14_11155 | AWH59_13765 | BN17_45831 | ERS150876_00075 | IY32_16590 | MTA/SAH nucleosidase | MTAN | S-adenosylhomocysteine nucleosidase | mtn | mtnN | pfs
Type:PROTEIN
Mol. Mass.:24362.21
Organism:Escherichia coli
Description:ChEMBL_109859
Residue:232
Sequence:
MKIGIIGAMEEEVTLLRDKIEKRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT
LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK
ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH
VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116357
NameBDBM50116357
Synonyms:CHEMBL3604360
TypeSmall organic molecule
Emp. Form.C13H19N5OS
Mol. Mass.293.388
SMILESCSC[C@@H]1CN(Cc2c[nH]c3c(N)ncnc23)C[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a