Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50117489
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1514397
IC50 16±n/a nM
Citation Boland, SBourin, AAlen, JGeraets, JSchroeders, PCastermans, KKindt, NBoumans, NPanitti, LVanormelingen, JFransen, SVan de Velde, SDefert, O Design, synthesis and biological characterization of selective LIMK inhibitors. Bioorg Med Chem Lett25:4005-10 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:72591.81
Organism:Homo sapiens
Description:gi_4505001
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117489
NameBDBM50117489
Synonyms:CHEMBL3613598
TypeSmall organic molecule
Emp. Form.C22H26N6O3
Mol. Mass.422.4802
SMILESCOC(=O)c1cccc(NC(=O)C2(CN)CCN(CC2)c2ncnc3[nH]cc(C)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a