Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid-sensing ion channel 5
LigandBDBM50124574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1520854
EC50 2800000±n/a nM
Citation Hendriks, CMPenning, TMZang, TWiemuth, DGründer, SSanhueza, IASchoenebeck, FBolm, C Pentafluorosulfanyl-containing flufenamic acid analogs: Syntheses, properties and biological activities. Bioorg Med Chem Lett25:4437-40 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid-sensing ion channel 5
Name:Acid-sensing ion channel 5
Synonyms:ASIC5 | Accn5 | Acid-sensing ion channel 5 | Amiloride-sensitive cation channel 5 | Asic5 | BLINaC | Blinac | Brain-liver-intestine amiloride-sensitive Na(+) channel
Type:PROTEIN
Mol. Mass.:56474.87
Organism:Rattus norvegicus
Description:ChEMBL_109894
Residue:495
Sequence:
MEHTEKSKGPAEKGLLGKIRRYLSKRPLPSPTDRKKFDHDFAISTSFHGIHNIAQNQNKV
RKVIWLSVVLGSVSLLVWQIYSRLVNYFMWPTTTSIEVQYVEKIEFPAVTFCNLNRFQTE
AVSRFGIIFFLWDIVSKVLRLQEISGNNTGSPEALDFVASHRNFSITEFVKNNGFYLNHD
TLVHCEFFGKTCDPKDFKHVFTEYGNCFTFNYGENVQSKNKVSVSGRGLKLLLDVHQEEF
TDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTIHQEYPWGECNP
DIKLRNFTTYSTYGCLKECKAKHIQRLCGCLPFLLPGNGVECDLLKYYNCVSPILDHIER
KGLCTMGTHNSSCPVPCEETEYPATIAYSTFPSQRATKFLAKKLNQSQEYIRENLVNIEI
NYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYLFTSFYWVFIFFLL
KILEMIQRTSPPQTV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124574
NameBDBM50124574
Synonyms:CHEMBL3623737
TypeSmall organic molecule
Emp. Form.C13H10F5NO2S
Mol. Mass.339.281
SMILESOC(=O)c1cccc(Nc2ccc(cc2)S(F)(F)(F)(F)F)c1
Structure
n/a