Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-serine O-palmitoleoyltransferase porcupine
LigandBDBM50125818
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1519628
IC50 0.570000±n/a nM
Citation Dong, YLi, KXu, ZMa, HZheng, JHu, ZHe, SWu, YSun, ZLuo, LLi, JZhang, HZhang, X Exploration of the linkage elements of porcupine antagonists led to potent Wnt signaling pathway inhibitors. Bioorg Med Chem23:6855-68 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Protein-serine O-palmitoleoyltransferase porcupine
Name:Protein-serine O-palmitoleoyltransferase porcupine
Synonyms:2.3.1.- | MG61 | PORC | PORCN | PPN | Protein MG61 | Protein-serine O-palmitoleoyltransferase porcupine
Type:PROTEIN
Mol. Mass.:52337.13
Organism:Homo sapiens
Description:ChEMBL_103574
Residue:461
Sequence:
MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGG
FFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTW
HKMRGAQMIVAMKAVSLGFDLDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAV
QGRPLSCRWLQKVARSLALALLCLVLSTCVGPYLFPYFIPLNGDRLLRNKKRKARGTMVR
WLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVE
VVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAFITYV
EHVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLAYLGSLFDVD
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125818
NameBDBM50125818
Synonyms:CHEMBL3623896
TypeSmall organic molecule
Emp. Form.C23H20N6O
Mol. Mass.396.4445
SMILESCc1ccc(cn1)-c1ncc(CC(=O)Nc2ccc(cn2)-c2cnccn2)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a