Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 2
LigandBDBM50126976
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1524156
IC50 6.5±n/a nM
Citation Abdelsamie, ASBey, EGargano, EMvan Koppen, CJEmpting, MFrotscher, M Towards the evaluation in an animal disease model: Fluorinated 17-HSD1 inhibitors showing strong activity towards both the human and the rat enzyme. Eur J Med Chem103:56-68 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 2
Name:Estradiol 17-beta-dehydrogenase 2
Synonyms:17-beta-Hydroxysteroid Dehydrogenase 2 (17-beta-HSD2) | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | Estradiol 17-beta-dehydrogenase 2 (17beta-HSD2) | Microsomal 17-beta-hydroxysteroid dehydrogenas | Testosterone 17-beta-dehydrogenase
Type:Oxidoreductase; single-pass type II membrane protein
Mol. Mass.:42795.29
Organism:Homo sapiens (Human)
Description:Enzyme was partially purified from human placenta.
Residue:387
Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50126976
NameBDBM50126976
Synonyms:CHEMBL3629590
TypeSmall organic molecule
Emp. Form.C20H15F2NO4S2
Mol. Mass.435.464
SMILESOc1ccc(F)c(C(=O)c2ccc(s2)-c2cccc(NS(=O)(=O)C3CC3)c2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a